Buy PNC-27 (5mg)

$142.00

Description
Reviews (0)

PNC-27 Peptide for Sale | The Groundbreaking Anti-Cancer Research Peptide

PNC 27 Peptide for Sale

Welcome to Planex Supplies, your trusted source for cutting-edge research peptides. If you are searching for PNC 27 peptide for sale, you have arrived at the right destination. Our PNC 27 peptide for sale is a high-purity, synthetic 32-amino acid peptide (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) that represents one of the most exciting developments in oncology research. This PNC 27 peptide for sale is a chimeric p53-penetrating peptide that binds to HDM-2 in a p53 peptide-like structure, inducing selective membrane-pore formation and leading to cancer cell lysis. Available in a 5mg lyophilized format, our PNC 27 peptide for sale is verified by third-party laboratories to ensure exceptional purity and potency.

Researchers seeking PNC 27 peptide for sale appreciate our transparent documentation, including batch-specific certificates of analysis. Browse our shop to explore our PNC 27 peptide for sale inventory. For related research compounds, visit our buy peptide online category. Our PNC 27 peptide for sale is intended for laboratory research use only, not for human consumption.

PNC 27 Peptide

PNC 27 peptide is a synthetic anti-cancer peptide that has gained significant attention in the scientific community due to its remarkable selectivity for cancer cells. This PNC 27 peptide contains an HDM-2-binding domain derived from the p53 transactivating domain (residues 12-26) linked to a cell-penetrating peptide (CPP) leader sequence. What makes this PNC 27 peptide truly revolutionary is its mechanism: it binds to HDM-2 protein expressed in the membranes of cancer cells—but not in normal (untransformed) cells. The PNC 27 peptide then forms 1:1 complexes with HDM-2, which dimerize to create transmembrane pores, leading to the rapid extrusion of cancer cell contents and tumor cell necrosis.

Studies have demonstrated that PNC 27 peptide kills a wide variety of solid tissue and hematopoietic cancer cells while having no effect on normal cells. This PNC 27 peptide has been shown to be effective against cervical cancer, pancreatic cancer, ovarian cancer, leukemia, and chemotherapy-resistant cancers. For PNC 27 peptide that meets rigorous research standards, choose Planex Supplies. Visit our homepage to learn more about PNC 27 peptide.

PNC 27 Price

The PNC 27 price at Planex Supplies reflects our commitment to providing exceptional value without compromising quality. Understanding PNC 27 price is essential for researchers planning their studies. Industry reference PNC 27 price points for 5mg typically range from $130 to $199. Our PNC 27 price is competitive and includes third-party testing, secure packaging, and tracking. When comparing PNC 27 price, consider that lower prices often indicate lower purity or lack of verification. The PNC 27 price for research-grade material is higher than unverified sources for good reason. We publish our PNC 27 price transparently on each product page. Volume discounts reduce the effective PNC 27 price for larger research projects. For accurate PNC 27 price information, visit our shop.

PNC 27 Peptide Price

The PNC 27 peptide price varies based on quantity and purity specifications. Our PNC 27 peptide price structure is designed to accommodate research needs of all scales. Reference PNC 27 peptide price points include: 5mg at $130-$199, 10mg at $210, 25mg at $420, and 50mg at $670. Our PNC 27 peptide price includes comprehensive documentation and quality assurance. When evaluating PNC 27 peptide price, researchers should consider the value of third-party verification. We offer competitive PNC 27 peptide price without compromising on the integrity of the product. For custom sizes, please contact us for a PNC 27 peptide price quote.

PNC 27 Prostate Cancer

PNC 27 prostate cancer research has shown promising results in preclinical studies. PNC 27 has been studied as a potential treatment for various types of cancer, including prostate cancer. The mechanism of PNC 27 prostate cancer action involves binding to HDM-2 expressed in the membranes of prostate cancer cells, leading to selective cancer cell death. Initial results from clinical trials studying PNC 27 prostate cancer have been promising, with the peptide showing significant anti-tumor activity and minimal toxicity. Researchers investigating PNC 27 prostate cancer can rely on our high-purity PNC 27 peptide for sale for their studies.

PNC-27 Peptide Dosing

PNC-27 peptide dosing is a critical parameter for research design. PNC-27 peptide dosing studies have demonstrated that this peptide exhibits dose-dependent cytotoxicity against cancer cells. In vitro PNC-27 peptide dosing at 50 μg/mL induced 100% cancer cell death within 90 minutes. In vivo PNC-27 peptide dosing research has utilized intraperitoneal injection at 40 mg/kg, administered once daily for 2-3 weeks, demonstrating significant anti-leukemic activity. The IC50 for PNC-27 peptide dosing against cervical cancer cells was determined to be 12.4 μM. Researchers should establish appropriate PNC-27 peptide dosing for their specific experimental models. For guidance on PNC-27 peptide dosing, contact our research support team.

PNC 27 10mg

PNC 27 10mg is a popular research quantity for extended studies. Our PNC 27 10mg offering provides researchers with sufficient material for comprehensive experiments. The PNC 27 10mg size is ideal for dose-response studies and multi-condition assays. Reference PNC 27 10mg pricing is available upon request. For PNC 27 10mg that meets rigorous research standards, choose Planex Supplies. Visit our shop for PNC 27 10mg availability.

PNC 27 5mg

PNC 27 5mg is our standard research package, ideal for initial studies and proof-of-concept experiments. This PNC 27 5mg quantity is sufficient for numerous in vitro assays and preliminary in vivo work. The PNC 27 5mg format provides excellent value for researchers beginning their investigation of this remarkable peptide. For PNC 27 5mg that meets the highest standards, choose Planex Supplies. Our PNC 27 5mg product includes full documentation and third-party verification.

PNC 27 Peptide Benefits

The PNC 27 peptide benefits for cancer research are extensive and well-documented. Key PNC 27 peptide benefits include:

Selective Cancer Cell Targeting: PNC-27 kills cancer cells while leaving normal cells unaffected due to the unique expression of HDM-2 in cancer cell membranes.
Novel Mechanism of Action: Through “poptosis” (peptide-induced pore formation), PNC-27 creates transmembrane pores that cause rapid cancer cell necrosis.
Broad Spectrum Activity: PNC-27 is effective against a wide variety of solid tissue and hematopoietic tumors.
Mitochondrial Disruption: PNC-27 enters cancer cells and binds to mitochondrial membranes, causing their disruption.
Chemotherapy-Resistant Cancers: PNC-27 is cytotoxic to chemotherapy-resistant cancers.
Minimal Off-Target Effects: Studies in animal models have shown no evidence of off-target effects.

These PNC 27 peptide benefits make it an invaluable tool for oncology research. When you choose our PNC 27 peptide for sale, you are investing in a compound with proven research potential.

PNC 27 Dosing Protocol

Developing a PNC 27 dosing protocol requires careful consideration of the research model and objectives. A typical PNC 27 dosing protocol for in vitro studies involves incubation at concentrations ranging from 12.4 μM (IC50 for cervical cancer cells) to 50 μg/mL. For in vivo PNC 27 dosing protocol, intraperitoneal injection at 40 mg/kg administered once daily for 2-3 weeks has demonstrated efficacy in mouse models. The PNC 27 dosing protocol should be tailored to the specific cancer cell line or animal model being studied. Our product documentation includes references to PNC 27 dosing protocol studies to support experimental design. For assistance with PNC 27 dosing protocol development, contact our research support team.

PNC 27 Buy Online

To PNC 27 buy online with confidence, choose Planex Supplies. When you PNC 27 buy online from us, you receive product with full documentation. The decision to PNC 27 buy online should include verification of testing protocols. We encourage you to PNC 27 buy online only from vendors who publish batch-specific purity data. Our customers PNC 27 buy online with confidence because we stand behind every product we sell. For PNC 27 buy online information, visit our shop.

PNC 28 Peptide

PNC 28 peptide is a closely related compound that shares the same HDM-2-binding domain but differs in its leader sequence. Both PNC 27 and PNC 28 peptides induce cancer cell death through a novel mechanism involving interaction with membrane-expressed HDM-2. PNC 28 peptide has been studied in pancreatic cancer research. Researchers interested in comparative studies may find value in exploring both PNC 27 and PNC 28 peptides. Our PNC 27 peptide for sale is the more extensively studied of the two compounds.

PNC 27 Dosage

PNC 27 dosage for research applications varies based on the experimental model. In vitro PNC 27 dosage studies have used concentrations of 50 μg/mL, which induced 100% cancer cell death within 90 minutes. The IC50 for PNC 27 dosage against cervical cancer cells was 12.4 μM. For in vivo PNC 27 dosage, 40 mg/kg administered intraperitoneally once daily for 2-3 weeks demonstrated significant anti-leukemic activity. Researchers should establish an appropriate PNC 27 dosage for their specific experimental design. For guidance on PNC 27 dosage, contact our research support team.

Where to Buy PNC 27

Where to buy PNC 27 is a question we answer every day. The answer is Planex Supplies, your premier source for research peptides. When researchers ask where to buy PNC 27, we provide a secure, verified platform with transparent pricing and documentation. For where to buy PNC 27, choose a supplier you can trust. For where to buy PNC 27, the answer is Planex Supplies.

Pnc 27 Peptide for Sale Usa

For researchers in the United States, pnc 27 peptide for sale usa is available through Planex Supplies. When you order pnc 27 peptide for sale usa from us, you receive fast domestic shipping. The pnc 27 peptide for sale usa process includes tracking and secure packaging. For pnc 27 peptide for sale usa information, visit our shop.

Pnc 28 Peptide Price

The pnc 28 peptide price is available upon request for researchers interested in this related compound. For pnc 28 peptide price information, contact our support team. Our PNC 27 peptide for sale offers exceptional value for oncology research.

PNC 27 for Sale

PNC 27 for sale at Planex Supplies is available in 5mg research quantities. The PNC 27 for sale inventory is regularly updated with fresh stock. When you see PNC 27 for sale elsewhere, request purity data before purchasing. Our PNC 27 for sale listings include detailed specifications, including molecular formula (C188H293N53O44S), molecular weight (4031.73), and purity (>98%). For PNC 27 for sale that researchers trust, choose Planex Supplies.

Buy PNC-27 Peptide

To Buy PNC-27 Peptide for your research, Planex Supplies offers a straightforward ordering process. When you Buy PNC-27 Peptide from us, you receive product that has been stored at optimal temperatures. The decision to Buy PNC-27 Peptide from a verified source protects your research investment. Many laboratories Buy PNC-27 Peptide repeatedly from us because of our consistent quality. Before you Buy PNC-27 Peptide elsewhere, request their testing documentation and compare it to ours. Our customers Buy PNC-27 Peptide with confidence knowing each batch is independently verified. For international researchers who Buy PNC-27 Peptide, we provide customs documentation to facilitate clearance.

PNC-27 Buy

To pnc-27 buy with confidence, choose Planex Supplies. When you pnc-27 buy from us, you benefit from our rigorous quality control and customer support. The decision to pnc-27 buy should include verification of the supplier’s testing protocols. We encourage you to pnc-27 buy only from vendors who publish batch-specific purity data. Our customers pnc-27 buy with confidence because we stand behind every product we sell. Before you pnc-27 buy, compare our pricing and documentation to other suppliers. For pnc-27 buy information, visit our shop.

PNC-27 Buy Online Store

As a pnc-27 buy online store, Planex Supplies prioritizes customer education and product quality. Our pnc-27 buy online store features detailed product specifications, including molecular weight, sequence, and purity data. When you visit our pnc-27 buy online store, you’ll find transparent pricing. The pnc-27 buy online store at Planex Supplies offers secure checkout and worldwide shipping. Researchers return to our pnc-27 buy online store for consistent quality. Explore our shop for the best pnc-27 buy online store experience.

Buy PNC-27 Peptide Online

To Buy PNC-27 Peptide online with confidence, choose Planex Supplies. When you Buy PNC-27 Peptide online from us, you receive the product with full documentation. The decision to Buy PNC-27 Peptide online should include verification of testing protocols. We encourage you to Buy PNC-27 Peptide online only from vendors who publish batch-specific purity data. Our customers Buy PNC-27 Peptide online with confidence. For Buy PNC-27 Peptide online information, visit our shop.

PNC-27 Peptide Price

The PNC-27 peptide Price at Planex Supplies reflects our commitment to quality. Our PNC-27 peptide Price includes third-party testing, secure packaging, and tracking. When comparing PNC-27 peptide Price, consider that lower prices often indicate lower purity. We publish our PNC-27 peptide Price transparently on each product page. Volume discounts reduce the effective PNC-27 peptide Price for larger orders. For accurate PNC-27 peptide Price information, visit our shop.

Buy PNC-27 Peptide Online UK

For United Kingdom researchers, we offer buy pnc-27 peptide online uk with proper documentation. When you order buy pnc-27 peptide online uk from Planex Supplies, you receive products compliant with UK research regulations. The buy pnc-27 peptide online uk process includes discreet packaging and tracking. UK researchers looking for buy pnc-27 peptide online uk appreciate our competitive pricing. Before you order buy pnc-27 peptide online uk from local sources, compare our purity documentation. Our buy pnc-27 peptide online uk customers receive the same quality as our global clientele.

Scientific Overview of PNC-27 Peptide Research

PNC-27 is a synthetic peptide that has been the subject of laboratory research regarding its potential interactions with cancer cell membranes. Derived from the p53 tumor suppressor protein, the peptide is engineered with a specific amino acid sequence designed to interact with the HDM2 protein.

Chemical Characteristics

The peptide is defined by the following molecular specifications:

- Sequence: H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH
- Molecular Formula: C188H293N53O44S
- Molecular Weight: 4031.7 g/mol

Research Mechanisms and Observations

Experimental studies have focused on the following theoretical mechanisms of action:

1. Targeting Membrane-Bound HDM2
In many laboratory models, it has been observed that certain malignant cells express the HDM2 protein on their external plasma membranes, whereas healthy cells typically maintain HDM2 within the nucleus or cytoplasm. Research explores whether the HDM2-binding domain of PNC-27 can selectively attach to these mislocalized proteins on the surface of tumor cells.

2. Theoretical Pore Formation
Scientific literature, including studies published in oncology journals, describes a process where the binding of PNC-27 to HDM2 may lead to the assembly of oligomeric pores. These ring-like structures are hypothesized to penetrate the lipid bilayer of the target cell.

3. Induced Membranolysis
The formation of these transmembrane pores is studied for its ability to compromise the physical integrity of the cell wall. In vitro observations suggest that this can lead to membranolysis, a process where the cell membrane is destroyed due to rapid changes in osmotic pressure, leading to cell necrosis.

Current Research Status

While laboratory findings have provided visual data of these interactions through techniques like immuno-electron microscopy, research into PNC-27 remains in the experimental stages. It is primarily utilized as a tool in cell biology to study protein-protein interactions and membrane dynamics.

It is important to note that this peptide is not an approved medical treatment. The safety and efficacy of PNC-27 have not been established in clinical settings, and its use is restricted to laboratory research environments. Information regarding this compound should not be used as a substitute for professional medical advice or established oncological protocols.

Frequently Asked Questions (FAQ)

Q1: Where can I find PNC 27 peptide for sale?
A1: You can find PNC 27 peptide for sale at Planex Supplies. Our PNC 27 peptide for sale is third-party tested. Visit our shop for PNC 27 peptide for sale with full documentation.

Q2: What is PNC-27 peptide?
A2: PNC 27 peptide is a 32-amino acid synthetic peptide (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) that contains an HDM-2-binding domain and a cell-penetrating peptide leader sequence. This PNC 27 peptide selectively kills cancer cells by binding to HDM-2 expressed in cancer cell membranes.

Q3: How does PNC-27 work?
A3: PNC-27 binds to the p53 binding site of HDM-2 (residues 1-109) in cancer cell membranes, inducing transmembrane pore formation and cancer cell necrosis. It also enters cancer cells and binds to mitochondrial membranes, causing their disruption. This PNC 27 mechanism is called “poptosis”.

Q4: What are the benefits of PNC-27 peptide?
A4: PNC 27 peptide benefits include selective cancer cell killing, broad-spectrum activity against solid tissue and hematopoietic tumors, effectiveness against chemotherapy-resistant cancers, and minimal off-target effects. These PNC 27 peptide benefits make it a valuable research tool.

Q5: What is the PNC-27 peptide dosing for research?
A5: PNC-27 peptide dosing in vitro typically uses 50 μg/mL or IC50 concentrations like 12.4 μM for cervical cancer cells. In vivo PNC-27 peptide dosing often uses 40 mg/kg intraperitoneally once daily for 2-3 weeks. Researchers should establish appropriate PNC-27 peptide dosing for their specific models.

Q6: Can I buy PNC-27 peptide for research in the UK?
A6: Yes, you can order buy pnc-27 peptide online uk from Planex Supplies. Our buy pnc-27 peptide online uk includes proper documentation. We provide buy pnc-27 peptide online uk with discreet shipping.

Q7: What is the difference between PNC-27 and PNC-28?
A7: Both PNC-27 and PNC-28 contain HDM-2-protein-binding domain sequences from p53 linked to a leader sequence that induces pore formation. PNC-28 has been studied in pancreatic cancer research. Our PNC 27 peptide for sale is the more extensively studied compound.

Q8: What is the PNC 27 price?
A8: Our PNC 27 price is competitive and includes purity verification. Reference PNC 27 price points: 5mg $130-$199, 10mg $210, 25mg $420. Check our shop for the current PNC 27 price.

Conclusion

In conclusion, PNC 27 peptide for sale at Planex Supplies represents a groundbreaking research compound with immense potential in oncology research. Whether you need PNC 27 peptide for cancer cell studies, PNC 27 peptide for sale for in vivo models, or PNC 27 peptide for sale for mechanistic research, we provide verified, documented products. Our PNC 27 peptide for sale is manufactured under strict quality controls and tested by independent laboratories.

Researchers seeking PNC 27 peptide for sale appreciate our transparent documentation and competitive pricing. When you Buy PNC-27 Peptide from us, you invest in research integrity. The PNC 27 peptide benefits, PNC-27 peptide dosing, and PNC 27 prostate cancer studies depend on reliable compounds – and Planex Supplies delivers. For pnc 27 peptide for sale usa, pnc-27 buy online store, or PNC 27 price inquiries, our team is ready to assist.

Understanding PNC 27 peptide mechanism, PNC 27 dosing protocol, and PNC 27 dosage supports responsible research design. Our PNC 27 peptide for sale documentation includes references to published literature. For where to buy PNC 27, PNC 27 buy online, or Buy PNC-27 Peptide online options, explore our catalog.

We invite you to explore our homepage, browse our shop, or visit our buy peptide online category. For alternative research supplies, trusted partners like Planex Psychedelics offer additional resources. Use Google, Yahoo, or Bing to research further, but when you’re ready for PNC 27 peptide for sale, choose Planex Supplies.